Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Immunogen

Synthetic peptide directed towards the middle region of Human SLC25A35

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST